EXOSC7 Antikörper (N-Term)
-
- Target Alle EXOSC7 Antikörper anzeigen
- EXOSC7 (Exosome Component 7 (EXOSC7))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EXOSC7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- EXOSC7 antibody was raised against the N terminal of EXOSC7
- Aufreinigung
- Purified
- Immunogen
- EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD
- Top Product
- Discover our top product EXOSC7 Primärantikörper
-
anti-Exosome Component 7 (EXOSC7) antibody
EXOSC7 Reaktivität: Human, Ratte, Maus, Hund, Affe WB, IHC, IF, IHC (p), FACS Wirt: Maus Monoclonal 1G8 unconjugated
anti-Exosome Component 7 (EXOSC7) (AA 1-291) antibodyEXOSC7 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Exosome Component 7 (EXOSC7) (AA 71-120) antibodyEXOSC7 Reaktivität: Human, Ratte, Maus, Hund, Rind (Kuh), Pferd, Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio), Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 7 (EXOSC7) antibodyEXOSC7 Reaktivität: Human WB, IHC Wirt: Kaninchen Monoclonal unconjugated
anti-Exosome Component 7 (EXOSC7) (N-Term) antibodyEXOSC7 Reaktivität: Human, Ratte, Maus, Hund, Rind (Kuh), Pferd, Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 7 (EXOSC7) (AA 21-120) antibodyEXOSC7 Reaktivität: Human, Ratte IF (cc), IF (p), ELISA, IHC (p), IHC (fro), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 7 (EXOSC7) antibodyEXOSC7 Reaktivität: Human, Ratte, Maus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 7 (EXOSC7) (AA 192-291) antibodyEXOSC7 Reaktivität: Human ELISA Wirt: Maus Monoclonal 2F10 unconjugated
anti-Exosome Component 7 (EXOSC7) (AA 1-291) antibodyEXOSC7 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Exosome Component 7 (EXOSC7) (AA 36-85) antibodyEXOSC7 Reaktivität: Human, Ratte, Maus, Hund, Rind (Kuh), Pferd, Schwein, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EXOSC7 Blocking Peptide, catalog no. 33R-4910, is also available for use as a blocking control in assays to test for specificity of this EXOSC7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOSC7 (Exosome Component 7 (EXOSC7))
- Andere Bezeichnung
- EXOSC7 (EXOSC7 Produkte)
- Synonyme
- EXOSC7 antikoerper, zgc:110717 antikoerper, EAP1 antikoerper, RRP42 antikoerper, Rrp42p antikoerper, hRrp42p antikoerper, p8 antikoerper, 2610002K22Rik antikoerper, AV212732 antikoerper, mKIAA0116 antikoerper, exosome component 7 antikoerper, exosome component 7 S homeolog antikoerper, exosc7 antikoerper, EXOSC7 antikoerper, exosc7.S antikoerper, Exosc7 antikoerper
- Hintergrund
- EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
- Molekulargewicht
- 32 kDa (MW of target protein)
-
