ISG20 Antikörper (N-Term)

Produktnummer ABIN629913

Produktdetails anti-ISG20 Antikörper

Target: ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ISG20 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ISG20 antibody was raised against the N terminal of ISG20

Aufreinigung: Purified

Immunogen: ISG20 antibody was raised using the N terminal of ISG20 corresponding to a region with amino acids GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ISG20 Blocking Peptide, catalog no. 33R-3179, is also available for use as a blocking control in assays to test for specificity of this ISG20 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISG20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ISG20

Target: ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))

Andere Bezeichnung: ISG20 (ISG20 Produkte)

Synonyme: ISG20 antikoerper, CD25 antikoerper, HEM45 antikoerper, 1600023I01Rik antikoerper, 2010107M23Rik antikoerper, 20kDa antikoerper, DnaQL antikoerper, interferon stimulated exonuclease gene 20 antikoerper, interferon-stimulated protein antikoerper, ISG20 antikoerper, Isg20 antikoerper

Hintergrund: ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.

Molekulargewicht: 20 kDa (MW of target protein)