RPP29 Antikörper
-
- Target Alle RPP29 (POP4) Antikörper anzeigen
- RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPP29 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- POP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL
- Top Product
- Discover our top product POP4 Primärantikörper
-
anti-Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4) (AA 1-220) antibody
POP4 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4) antibodyPOP4 Reaktivität: Human, Ratte, Maus IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4) (AA 1-220) antibodyPOP4 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4) (C-Term) antibodyPOP4 Reaktivität: Human, Rind (Kuh), Affe, Schwein, Hund, Kaninchen, Meerschweinchen, Pferd, Fledermaus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4) antibodyPOP4 Reaktivität: Human, Ratte, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4) (AA 121-220) antibodyPOP4 Reaktivität: Human ELISA, WB Wirt: Maus Polyclonal unconjugated
anti-Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4) (C-Term) antibodyPOP4 Reaktivität: Human, Ratte, Maus, Rind (Kuh), Hund, Kaninchen, Meerschweinchen, Pferd, Saccharomyces cerevisiae, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POP4 Blocking Peptide, catalog no. 33R-2327, is also available for use as a blocking control in assays to test for specificity of this POP4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POP4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))
- Andere Bezeichnung
- POP4 (POP4 Produkte)
- Synonyme
- POP4 antikoerper, RPP29 antikoerper, 1110023P21Rik antikoerper, Rpp29 antikoerper, zgc:110597 antikoerper, rpp29 antikoerper, POP4 homolog, ribonuclease P/MRP subunit antikoerper, processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae) antikoerper, POP4 homolog, ribonuclease P/MRP subunit L homeolog antikoerper, POP4 antikoerper, Pop4 antikoerper, pop4 antikoerper, pop4.L antikoerper
- Hintergrund
- POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.
- Molekulargewicht
- 24 kDa (MW of target protein)
-
