Trnt1 Antikörper (N-Term)
-
- Target Alle Trnt1 Antikörper anzeigen
- Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Trnt1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- TRNT1 antibody was raised against the N terminal of TRNT1
- Aufreinigung
- Purified
- Immunogen
- TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
- Top Product
- Discover our top product Trnt1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRNT1 Blocking Peptide, catalog no. 33R-7294, is also available for use as a blocking control in assays to test for specificity of this TRNT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRNT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))
- Andere Bezeichnung
- TRNT1 (Trnt1 Produkte)
- Synonyme
- bMtCCA antikoerper, zgc:86645 antikoerper, cca1 antikoerper, mtcca antikoerper, cgi-47 antikoerper, TRNT1 antikoerper, CCA1 antikoerper, MtCCA antikoerper, 2410043H24Rik antikoerper, 2610044E04Rik antikoerper, 9830143O18Rik antikoerper, AA408384 antikoerper, C76540 antikoerper, CGI-47 antikoerper, mt-Trat antikoerper, tRNA nucleotidyl transferase 1 antikoerper, tRNA nucleotidyl transferase, CCA-adding, 1 antikoerper, tRNA nucleotidyl transferase, CCA-adding, 1 L homeolog antikoerper, TRNT1 antikoerper, trnt1 antikoerper, trnt1.L antikoerper, Trnt1 antikoerper
- Hintergrund
- TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.
- Molekulargewicht
- 45 kDa (MW of target protein)
-