UPF3B Antikörper
-
- Target Alle UPF3B Antikörper anzeigen
- UPF3B (UPF3 Regulator of Nonsense Transcripts Homolog B (UPF3B))
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UPF3B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- UPF3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL
- Top Product
- Discover our top product UPF3B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UPF3B Blocking Peptide, catalog no. 33R-6132, is also available for use as a blocking control in assays to test for specificity of this UPF3B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UPF3B (UPF3 Regulator of Nonsense Transcripts Homolog B (UPF3B))
- Andere Bezeichnung
- UPF3B (UPF3B Produkte)
- Hintergrund
- UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions.
- Molekulargewicht
- 52 kDa (MW of target protein)
-