CDKN2AIP Antikörper (C-Term)

Produktnummer ABIN629922

Produktdetails anti-CDKN2AIP Antikörper

Target: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDKN2AIP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CARF antibody was raised against the C terminal Of Carf

Aufreinigung: Purified

Immunogen: CARF antibody was raised using the C terminal Of Carf corresponding to a region with amino acids AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS

Anwendungsinformationen

Applikationshinweise: WB: 0.3125 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CARF Blocking Peptide, catalog no. 33R-1263, is also available for use as a blocking control in assays to test for specificity of this CARF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDKN2AIP

Target: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Andere Bezeichnung: CARF (CDKN2AIP Produkte)

Synonyme: CARF antikoerper, 4921511I16Rik antikoerper, AW208986 antikoerper, CDKN2AIP antikoerper, RGD1305302 antikoerper, CDKN2A interacting protein antikoerper, CDKN2A interacting protein L homeolog antikoerper, CDKN2AIP antikoerper, Cdkn2aip antikoerper, cdkn2aip antikoerper, cdkn2aip.L antikoerper

Hintergrund: CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2.

Molekulargewicht: 64 kDa (MW of target protein)