SNRPA1 Antikörper (C-Term)

Produktnummer ABIN629923

Produktdetails anti-SNRPA1 Antikörper

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Bindungsspezifität: C-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRPA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SNRPA1 antibody was raised against the C terminal of SNRPA1

Aufreinigung: Purified

Immunogen: SNRPA1 antibody was raised using the C terminal of SNRPA1 corresponding to a region with amino acids RRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQ

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRPA1 Blocking Peptide, catalog no. 33R-8161, is also available for use as a blocking control in assays to test for specificity of this SNRPA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRPA1

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Andere Bezeichnung: SNRPA1 (SNRPA Produkte)

Synonyme: Mud1 antikoerper, U1-A antikoerper, U1A antikoerper, im:7142962 antikoerper, zgc:101832 antikoerper, C430021M15Rik antikoerper, Rnu1a-1 antikoerper, Rnu1a1 antikoerper, mud1 antikoerper, snf antikoerper, fc19d01 antikoerper, wu:fc19d01 antikoerper, zgc:77810 antikoerper, T30B22.12 antikoerper, U1SNRNP-SPECIFIC PROTEIN antikoerper, spliceosomal protein U1A antikoerper, small nuclear ribonucleoprotein polypeptide A antikoerper, small nuclear ribonucleoprotein polypeptide A' antikoerper, small nuclear ribonucleoprotein polypeptide A S homeolog antikoerper, spliceosomal protein U1A antikoerper, SNRPA antikoerper, snrpa1 antikoerper, Snrpa antikoerper, snrpa.S antikoerper, snrpa antikoerper, U1A antikoerper

Hintergrund: SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.

Molekulargewicht: 18 kDa (MW of target protein)