CPSF3 Antikörper (C-Term)

Produktnummer ABIN629924

Produktdetails anti-CPSF3 Antikörper

Target: CPSF3 (Cleavage and Polyadenylation Specific Factor 3, 73kDa (CPSF3))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPSF3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CPSF3 antibody was raised against the C terminal of CPSF3

Aufreinigung: Purified

Immunogen: CPSF3 antibody was raised using the C terminal of CPSF3 corresponding to a region with amino acids DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEAL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CPSF3 Blocking Peptide, catalog no. 33R-1889, is also available for use as a blocking control in assays to test for specificity of this CPSF3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPSF3

Target: CPSF3 (Cleavage and Polyadenylation Specific Factor 3, 73kDa (CPSF3))

Andere Bezeichnung: CPSF3 (CPSF3 Produkte)

Synonyme: CPSF3 antikoerper, si:dkey-81b15.1 antikoerper, wu:fc32f10 antikoerper, zgc:101655 antikoerper, CPSF-73 antikoerper, CPSF73 antikoerper, cleavage and polyadenylation specific factor 3 antikoerper, cleavage and polyadenylation specificity factor subunit 3 antikoerper, cleavage and polyadenylation specific factor 3 L homeolog antikoerper, cleavage and polyadenylation specific factor 3, 73kDa antikoerper, cleavage and polyadenylation specificity factor 3 antikoerper, CPSF3 antikoerper, cpsf3 antikoerper, CpipJ_CPIJ011955 antikoerper, CMU_024380 antikoerper, PITG_07110 antikoerper, cpsf3.L antikoerper, Cpsf3 antikoerper

Hintergrund: CPSF3 belongs to the RNA-metabolizing metallo-beta-lactamase-like family, CPSF3 subfamily. It is component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition.

Molekulargewicht: 75 kDa (MW of target protein)