DAZAP1 Antikörper (C-Term)

Produktnummer ABIN629928

Produktdetails anti-DAZAP1 Antikörper

Target: DAZAP1 (DAZ Associated Protein 1 (DAZAP1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAZAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: DAZAP1 antibody was raised against the C terminal of DAZAP1

Aufreinigung: Purified

Immunogen: DAZAP1 antibody was raised using the C terminal of DAZAP1 corresponding to a region with amino acids LAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQP

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAZAP1 Blocking Peptide, catalog no. 33R-4764, is also available for use as a blocking control in assays to test for specificity of this DAZAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAZAP1

Target: DAZAP1 (DAZ Associated Protein 1 (DAZAP1))

Andere Bezeichnung: DAZAP1 (DAZAP1 Produkte)

Synonyme: MGC89358 antikoerper, DAZAP1 antikoerper, 2410042M16Rik antikoerper, mPrrp antikoerper, DAZ associated protein 1 antikoerper, DAZ associated protein 1 L homeolog antikoerper, dazap1 antikoerper, DAZAP1 antikoerper, Dazap1 antikoerper, dazap1.L antikoerper

Hintergrund: In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis.

Molekulargewicht: 45 kDa (MW of target protein)