CPEB2 Antikörper (Middle Region)

Produktnummer ABIN629930

Produktdetails anti-CPEB2 Antikörper

Target: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPEB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CPEB2 antibody was raised against the middle region of CPEB2

Aufreinigung: Purified

Immunogen: CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CPEB2 Blocking Peptide, catalog no. 33R-2191, is also available for use as a blocking control in assays to test for specificity of this CPEB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPEB2

Target: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Andere Bezeichnung: CPEB2 (CPEB2 Produkte)

Synonyme: CPE-BP2 antikoerper, CPEB-2 antikoerper, hCPEB-2 antikoerper, A630055H10Rik antikoerper, Cpe-bp2 antikoerper, CPEB2 antikoerper, DKFZp469M211 antikoerper, cytoplasmic polyadenylation element binding protein 2 antikoerper, cytoplasmic polyadenylation element-binding protein 2 antikoerper, CPEB2 antikoerper, Cpeb2 antikoerper, cpeb2 antikoerper, LOC100351062 antikoerper

Hintergrund: CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.

Molekulargewicht: 37 kDa (MW of target protein)