Fibrillarin Antikörper (N-Term)

Produktnummer ABIN629933

Produktdetails anti-Fibrillarin Antikörper

Target: Fibrillarin (FBL)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Fibrillarin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Fibrillarin antibody was raised against the N terminal of FBL

Aufreinigung: Purified

Immunogen: Fibrillarin antibody was raised using the N terminal of FBL corresponding to a region with amino acids GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Fibrillarin Blocking Peptide, catalog no. 33R-3279, is also available for use as a blocking control in assays to test for specificity of this Fibrillarin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Fibrillarin

Target: Fibrillarin (FBL)

Andere Bezeichnung: Fibrillarin (FBL Produkte)

Synonyme: FIB antikoerper, FLRN antikoerper, RNU3IP1 antikoerper, wu:fb37g12 antikoerper, zgc:56145 antikoerper, zgc:77130 antikoerper, FBL antikoerper, AL022665 antikoerper, CG9888 antikoerper, Dmel\\CG9888 antikoerper, Fibri antikoerper, GCR-6 antikoerper, GCR6 antikoerper, Pen59C5 antikoerper, fib antikoerper, pen59C5 antikoerper, MGC76139 antikoerper, fbl antikoerper, fibrillarin antikoerper, Fibrillarin antikoerper, putative fibrillarin antikoerper, fibrillarin S homeolog antikoerper, FBL antikoerper, fbl antikoerper, Fbl antikoerper, Fib antikoerper, fib1 antikoerper, LMJF_19_0100 antikoerper, fbl.S antikoerper

Hintergrund: FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognise fibrillarin.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process