HNRNPA0 Antikörper (Middle Region)
-
- Target Alle HNRNPA0 Antikörper anzeigen
- HNRNPA0 (Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HNRNPA0 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- HNRPA0 antibody was raised against the middle region of HNRPA0
- Aufreinigung
- Purified
- Immunogen
- HNRPA0 antibody was raised using the middle region of HNRPA0 corresponding to a region with amino acids KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
- Top Product
- Discover our top product HNRNPA0 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HNRPA0 Blocking Peptide, catalog no. 33R-4234, is also available for use as a blocking control in assays to test for specificity of this HNRPA0 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPA0 (Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0))
- Andere Bezeichnung
- HNRPA0 (HNRNPA0 Produkte)
- Synonyme
- HNRPA0 antikoerper, 1110055B05Rik antikoerper, 3010025E17Rik antikoerper, Hnrpa0 antikoerper, hnRNP A0 antikoerper, fc01g05 antikoerper, wu:fc01g05 antikoerper, zgc:77366 antikoerper, fi36h08 antikoerper, hnrnpa0 antikoerper, hnrpa0 antikoerper, wu:fa16d06 antikoerper, wu:fi36h08 antikoerper, zgc:77280 antikoerper, MGC53160 antikoerper, MGC130809 antikoerper, RGD1563684 antikoerper, HNRNPA0 antikoerper, heterogeneous nuclear ribonucleoprotein A0 antikoerper, heterogeneous nuclear ribonucleoprotein A0a antikoerper, heterogeneous nuclear ribonucleoprotein A0b antikoerper, heterogeneous nuclear ribonucleoprotein A0 L homeolog antikoerper, Heterogeneous nuclear ribonucleoprotein A0 antikoerper, HNRNPA0 antikoerper, Hnrnpa0 antikoerper, hnrnpa0a antikoerper, hnrnpa0b antikoerper, hnrpa0 antikoerper, hnrnpa0 antikoerper, hnrnpa0.L antikoerper, roa0 antikoerper
- Hintergrund
- HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.
- Molekulargewicht
- 34 kDa (MW of target protein)
-