NXF3 Antikörper (C-Term)

Produktnummer ABIN629937

Produktdetails anti-NXF3 Antikörper

Target: NXF3 (Nuclear RNA Export Factor 3 (NXF3))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NXF3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: NXF3 antibody was raised against the C terminal of NXF3

Aufreinigung: Purified

Immunogen: NXF3 antibody was raised using the C terminal of NXF3 corresponding to a region with amino acids SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NXF3 Blocking Peptide, catalog no. 33R-8801, is also available for use as a blocking control in assays to test for specificity of this NXF3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NXF3

Target: NXF3 (Nuclear RNA Export Factor 3 (NXF3))

Andere Bezeichnung: NXF3 (NXF3 Produkte)

Synonyme: NXF3 antikoerper, Gm384 antikoerper, RGD1564923 antikoerper, nuclear RNA export factor 3 antikoerper, NXF3 antikoerper, LOC523530 antikoerper, LOC100060140 antikoerper, LOC100060240 antikoerper, LOC785244 antikoerper, Nxf3 antikoerper

Hintergrund: NXF3 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF3 has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus.

Molekulargewicht: 58 kDa (MW of target protein)