NOVA2 Antikörper (Middle Region)

Produktnummer ABIN629943

Produktdetails anti-NOVA2 Antikörper

Target: NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOVA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NOVA2 antibody was raised against the middle region of NOVA2

Aufreinigung: Purified

Immunogen: NOVA2 antibody was raised using the middle region of NOVA2 corresponding to a region with amino acids EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOVA2 Blocking Peptide, catalog no. 33R-2631, is also available for use as a blocking control in assays to test for specificity of this NOVA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOVA2

Target: NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))

Andere Bezeichnung: NOVA2 (NOVA2 Produkte)

Synonyme: NOVA2 antikoerper, anova antikoerper, nova3 antikoerper, MGC97842 antikoerper, nova1a antikoerper, ANOVA antikoerper, NOVA3 antikoerper, Gm1424 antikoerper, nova1 antikoerper, NOVA alternative splicing regulator 2 antikoerper, neuro-oncological ventral antigen 2 antikoerper, neuro-oncological ventral antigen 2 L homeolog antikoerper, NOVA2 antikoerper, nova2 antikoerper, Nova2 antikoerper, nova2.L antikoerper

Hintergrund: NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.

Molekulargewicht: 54 kDa (MW of target protein)