NOVA2 Antikörper (Middle Region)
-
- Target Alle NOVA2 Antikörper anzeigen
- NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NOVA2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NOVA2 antibody was raised against the middle region of NOVA2
- Aufreinigung
- Purified
- Immunogen
- NOVA2 antibody was raised using the middle region of NOVA2 corresponding to a region with amino acids EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASP
- Top Product
- Discover our top product NOVA2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NOVA2 Blocking Peptide, catalog no. 33R-2631, is also available for use as a blocking control in assays to test for specificity of this NOVA2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))
- Andere Bezeichnung
- NOVA2 (NOVA2 Produkte)
- Hintergrund
- NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.
- Molekulargewicht
- 54 kDa (MW of target protein)
-