DDX47 Antikörper
-
- Target Alle DDX47 Antikörper anzeigen
- DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDX47 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETP
- Top Product
- Discover our top product DDX47 Primärantikörper
-
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) (AA 353-380), (C-Term) antibody
DDX47 Reaktivität: Human, Maus WB, FACS Wirt: Kaninchen Polyclonal RB27513 unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) (AA 1-455) antibodyDDX47 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) (C-Term) antibodyDDX47 Reaktivität: Human, Maus, Ratte, Kaninchen, Pferd, Meerschweinchen WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) (C-Term) antibodyDDX47 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Pferd, Meerschweinchen, Rind (Kuh), Saccharomyces cerevisiae WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) (AA 225-460) antibodyDDX47 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) (AA 186-455) antibodyDDX47 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) (AA 41-90) antibodyDDX47 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Pferd, Rind (Kuh), Schwein, Fledermaus, Affe, Huhn, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) (N-Term) antibodyDDX47 Reaktivität: Human, Maus, Ratte, Kaninchen, Pferd, Meerschweinchen, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) (N-Term) antibodyDDX47 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Pferd, Meerschweinchen, Rind (Kuh), Saccharomyces cerevisiae WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDX47 Blocking Peptide, catalog no. 33R-7625, is also available for use as a blocking control in assays to test for specificity of this DDX47 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX47 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))
- Andere Bezeichnung
- DDX47 (DDX47 Produkte)
- Synonyme
- ddx47 antikoerper, DDX47 antikoerper, E4-DBP antikoerper, HQ0256 antikoerper, MSTP162 antikoerper, RRP3 antikoerper, 4930588A18Rik antikoerper, C77285 antikoerper, DEAD-box helicase 47 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 antikoerper, DEAD-box helicase 47 L homeolog antikoerper, DDX47 antikoerper, ddx47 antikoerper, Ddx47 antikoerper, ddx47.L antikoerper
- Hintergrund
- DDX47 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.
- Molekulargewicht
- 50 kDa (MW of target protein)
-
