DDX23 Antikörper

Produktnummer ABIN629956

Produktdetails anti-DDX23 Antikörper

Target: DDX23 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 23 (DDX23))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DDX23 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX23 Blocking Peptide, catalog no. 33R-2328, is also available for use as a blocking control in assays to test for specificity of this DDX23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX23

Target: DDX23 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 23 (DDX23))

Andere Bezeichnung: DDX23 (DDX23 Produkte)

Synonyme: PRPF28 antikoerper, SNRNP100 antikoerper, U5-100K antikoerper, U5-100KD antikoerper, prp28 antikoerper, wu:fi39b12 antikoerper, zgc:63742 antikoerper, 3110082M05Rik antikoerper, 4921506D17Rik antikoerper, DEAD-box helicase 23 antikoerper, U5 snRNP 100 kD protein antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 antikoerper, DDX23 antikoerper, cgd3_3690 antikoerper, Chro.30417 antikoerper, PY04051 antikoerper, ddx23 antikoerper, Ddx23 antikoerper

Hintergrund: DDX23 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molekulargewicht: 90 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization