EIF4A3 Antikörper

Produktnummer ABIN629957

Produktdetails anti-EIF4A3 Antikörper

Target: EIF4A3 (Eukaryotic Translation Initiation Factor 4A3 (EIF4A3))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio), C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DDX48 antibody was raised using a synthetic peptide corresponding to a region with amino acids QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX48 Blocking Peptide, catalog no. 33R-7488, is also available for use as a blocking control in assays to test for specificity of this DDX48 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX48 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4A3

Target: EIF4A3 (Eukaryotic Translation Initiation Factor 4A3 (EIF4A3))

Andere Bezeichnung: DDX48 (EIF4A3 Produkte)

Synonyme: DDX48 antikoerper, NMP265 antikoerper, NUK34 antikoerper, eIF4AIII antikoerper, 2400003O03Rik antikoerper, Ddx48 antikoerper, eIF4A-III antikoerper, mKIAA0111 antikoerper, ddx48 antikoerper, nuk34 antikoerper, nmp265 antikoerper, eif4aiii antikoerper, EIF4A3 antikoerper, eif4a3 antikoerper, zgc:56139 antikoerper, XeIF-4AIII antikoerper, eif4a3-B antikoerper, eukaryotic translation initiation factor 4A3 antikoerper, eukaryotic initiation factor 4A-III antikoerper, eukaryotic translation initiation factor 4A3 S homeolog antikoerper, Eukaryotic initiation factor 4A-III antikoerper, EIF4A3 antikoerper, Eif4a3 antikoerper, eif4a3 antikoerper, LOC100185906 antikoerper, eif4a3.S antikoerper, if4a3 antikoerper

Hintergrund: DDX48 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molekulargewicht: 45 kDa (MW of target protein)