DDX46 Antikörper

Produktnummer ABIN629960

Produktdetails anti-DDX46 Antikörper

Target: DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX46 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DDX46 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX46 Blocking Peptide, catalog no. 33R-3247, is also available for use as a blocking control in assays to test for specificity of this DDX46 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX46 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX46

Target: DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))

Andere Bezeichnung: DDX46 (DDX46 Produkte)

Synonyme: MMI9.2 antikoerper, MMI9_2 antikoerper, RNA HELICASE antikoerper, fb39a03 antikoerper, fj67d06 antikoerper, wu:fb39a03 antikoerper, wu:fj67d06 antikoerper, PRPF5 antikoerper, Prp5 antikoerper, 2200005K02Rik antikoerper, 8430438J23Rik antikoerper, AI325430 antikoerper, AI957095 antikoerper, mKIAA0801 antikoerper, DEAD box RNA helicase (PRH75) antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 antikoerper, DEAD-box helicase 46 antikoerper, RNA helicase-like protein antikoerper, PRH75 antikoerper, ddx46 antikoerper, DDX46 antikoerper, Ddx46 antikoerper, TDRD12 antikoerper

Hintergrund: DDX46 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX46 is a component of the 17S U2 snRNP complex, it plays an important role in pre-mRNA splicing.

Molekulargewicht: 113 kDa (MW of target protein)