DDX19B Antikörper

Produktnummer ABIN629961

Produktdetails anti-DDX19B Antikörper

Target: DDX19B (DEAD (Asp-Glu-Ala-As) Box Polypeptide 19B (DDX19B))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX19B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DDX19 B antibody was raised using a synthetic peptide corresponding to a region with amino acids GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX19B Blocking Peptide, catalog no. 33R-3358, is also available for use as a blocking control in assays to test for specificity of this DDX19B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX19B

Target: DDX19B (DEAD (Asp-Glu-Ala-As) Box Polypeptide 19B (DDX19B))

Andere Bezeichnung: DDX19B (DDX19B Produkte)

Synonyme: DBP5 antikoerper, DDX19 antikoerper, RNAh antikoerper, 2810457M08Rik antikoerper, 4921519L13Rik antikoerper, AW260119 antikoerper, MGC75870 antikoerper, DDX19B antikoerper, Zd10a antikoerper, ddx19 antikoerper, DEAD-box helicase 19B antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 19b antikoerper, ATP-dependent RNA helicase DDX19B antikoerper, DEAD (Asp-Glu-Ala-As) box polypeptide 19B antikoerper, DEAD-box helicase 19B S homeolog antikoerper, DDX19B antikoerper, Ddx19b antikoerper, ddx19b antikoerper, LOC100054938 antikoerper, LOC100075859 antikoerper, LOC100581804 antikoerper, ddx19b.S antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX19B is a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities.

Molekulargewicht: 53 kDa (MW of target protein)