FARS2 Antikörper (N-Term)

Produktnummer ABIN629969

Produktdetails anti-FARS2 Antikörper

Target: FARS2 (Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FARS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: FARS2 antibody was raised against the N terminal of FARS2

Aufreinigung: Purified

Immunogen: FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FARS2 Blocking Peptide, catalog no. 33R-9501, is also available for use as a blocking control in assays to test for specificity of this FARS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FARS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FARS2

Target: FARS2 (Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2))

Andere Bezeichnung: FARS2 (FARS2 Produkte)

Synonyme: 2810431B21Rik antikoerper, 6720478K01Rik antikoerper, Fars1 antikoerper, COXPD14 antikoerper, FARS1 antikoerper, HSPC320 antikoerper, PheRS antikoerper, dJ520B18.2 antikoerper, phenylalanine-tRNA synthetase 2 (mitochondrial) antikoerper, phenylalanyl-tRNA synthetase 2, mitochondrial antikoerper, Fars2 antikoerper, FARS2 antikoerper

Hintergrund: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS2 is a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm.

Molekulargewicht: 50 kDa (MW of target protein)