DDX1 Antikörper

Produktnummer ABIN629970

Produktdetails anti-DDX1 Antikörper

Target: DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX1 Blocking Peptide, catalog no. 33R-8730, is also available for use as a blocking control in assays to test for specificity of this DDX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX1

Target: DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1 (DDX1))

Andere Bezeichnung: DDX1 (DDX1 Produkte)

Synonyme: CG9054 antikoerper, DDX1 antikoerper, Dbp79E antikoerper, DmDDX1 antikoerper, DmRH12 antikoerper, Dmel\\CG9054 antikoerper, anon-79E antikoerper, DBP-RB antikoerper, UKVH5d antikoerper, si:ch211-214k9.2 antikoerper, si:dkey-161f12.1 antikoerper, AA409185 antikoerper, Dead-box-1 antikoerper, DEAD-box helicase 1 antikoerper, DEAD/H-box helicase 1 L homeolog antikoerper, DEAD (Asp-Glu-Ala-Asp) box helicase 1 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 antikoerper, Ddx1 antikoerper, DDX1 antikoerper, ddx1.L antikoerper, ddx1 antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.

Molekulargewicht: 81 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization