RPL9 Antikörper (C-Term)

Produktnummer ABIN629974

Produktdetails anti-RPL9 Antikörper

Target: RPL9 (Ribosomal Protein L9 (RPL9))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPL9 antibody was raised against the C terminal of RPL9

Aufreinigung: Purified

Immunogen: RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL9 Blocking Peptide, catalog no. 33R-2552, is also available for use as a blocking control in assays to test for specificity of this RPL9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL9

Target: RPL9 (Ribosomal Protein L9 (RPL9))

Andere Bezeichnung: RPL9 (RPL9 Produkte)

Synonyme: CG6141 antikoerper, Dmel\\CG6141 antikoerper, L9 antikoerper, M(2)32D antikoerper, Rp L9 antikoerper, Rpl9 antikoerper, anon-EST:fe3A6 antikoerper, anon-WO0153538.25 antikoerper, anon-WO0153538.26 antikoerper, anon-WO0153538.27 antikoerper, rpL9 antikoerper, ab02c03 antikoerper, fa93a01 antikoerper, mg:ab02c03 antikoerper, wu:fa93a01 antikoerper, zgc:103730 antikoerper, NPC-A-16 antikoerper, Ribosomal protein L9 antikoerper, 60S ribosomal protein L9 antikoerper, ribosomal protein L9 antikoerper, ribosomal protein L9 L homeolog antikoerper, RpL9 antikoerper, rpl-9 antikoerper, rpl9 antikoerper, rpl9.L antikoerper, RPL9 antikoerper, Rpl9 antikoerper

Hintergrund: RPL9 is a ribosomal protein that is a component of the 60S subunit. RPL9 belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 21 kDa (MW of target protein)