EIF3G Antikörper (N-Term)

Produktnummer ABIN629975

Produktdetails anti-EIF3G Antikörper

Target: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF3G Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: EIF3 S4 antibody was raised against the N terminal of EIF3 4

Aufreinigung: Purified

Immunogen: EIF3 S4 antibody was raised using the N terminal of EIF3 4 corresponding to a region with amino acids SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF3S4 Blocking Peptide, catalog no. 33R-8672, is also available for use as a blocking control in assays to test for specificity of this EIF3S4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF3G

Target: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Andere Bezeichnung: EIF3S4 (EIF3G Produkte)

Synonyme: EIF3-P42 antikoerper, EIF3S4 antikoerper, eIF3-delta antikoerper, eIF3-p44 antikoerper, 44kDa antikoerper, D0Jmb4 antikoerper, Eif3s4 antikoerper, TU-189B2 antikoerper, p44 antikoerper, eif3s4 antikoerper, zgc:56553 antikoerper, eIF3g-A antikoerper, eif3s4-A antikoerper, eIF3g antikoerper, eIF3-S4 antikoerper, An16g05260 antikoerper, AO090011000648 antikoerper, eukaryotic translation initiation factor 3 subunit G antikoerper, eukaryotic translation initiation factor 3, subunit G antikoerper, eukaryotic translation initiation factor 3 subunit G S homeolog antikoerper, Eukaryotic translation initiation factor 3 subunit G antikoerper, eukaryotic translation initiation factor antikoerper, EIF3G antikoerper, Eif3g antikoerper, eif3g antikoerper, eif3g.S antikoerper, eif-3.G antikoerper, eIF3g antikoerper, ANI_1_732144 antikoerper, AOR_1_1112054 antikoerper, VDBG_00824 antikoerper, MGYG_08099 antikoerper, Tsp_04379 antikoerper

Hintergrund: EIF3S4 contains 1 RRM (RNA recognition motif) domain. It binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. This subunit binds to the 18S rRNA.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization