EIF3G Antikörper (N-Term)
-
- Target Alle EIF3G Antikörper anzeigen
- EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF3G Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- EIF3 S4 antibody was raised against the N terminal of EIF3 4
- Aufreinigung
- Purified
- Immunogen
- EIF3 S4 antibody was raised using the N terminal of EIF3 4 corresponding to a region with amino acids SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK
- Top Product
- Discover our top product EIF3G Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF3S4 Blocking Peptide, catalog no. 33R-8672, is also available for use as a blocking control in assays to test for specificity of this EIF3S4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))
- Andere Bezeichnung
- EIF3S4 (EIF3G Produkte)
- Synonyme
- EIF3-P42 antikoerper, EIF3S4 antikoerper, eIF3-delta antikoerper, eIF3-p44 antikoerper, 44kDa antikoerper, D0Jmb4 antikoerper, Eif3s4 antikoerper, TU-189B2 antikoerper, p44 antikoerper, eif3s4 antikoerper, zgc:56553 antikoerper, eIF3g-A antikoerper, eif3s4-A antikoerper, eIF3g antikoerper, eIF3-S4 antikoerper, An16g05260 antikoerper, AO090011000648 antikoerper, eukaryotic translation initiation factor 3 subunit G antikoerper, eukaryotic translation initiation factor 3, subunit G antikoerper, eukaryotic translation initiation factor 3 subunit G S homeolog antikoerper, Eukaryotic translation initiation factor 3 subunit G antikoerper, eukaryotic translation initiation factor antikoerper, EIF3G antikoerper, Eif3g antikoerper, eif3g antikoerper, eif3g.S antikoerper, eif-3.G antikoerper, eIF3g antikoerper, ANI_1_732144 antikoerper, AOR_1_1112054 antikoerper, VDBG_00824 antikoerper, MGYG_08099 antikoerper, Tsp_04379 antikoerper
- Hintergrund
- EIF3S4 contains 1 RRM (RNA recognition motif) domain. It binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. This subunit binds to the 18S rRNA.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-