SRP14 Antikörper
-
- Target Alle SRP14 Antikörper anzeigen
- SRP14 (Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14))
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SRP14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SRP14 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL
- Top Product
- Discover our top product SRP14 Primärantikörper
-
anti-Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14) antibody
SRP14 Reaktivität: Human, Ratte, Maus IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14) (Internal Region) antibodySRP14 Reaktivität: Human, Ratte WB, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14) (AA 38-87) antibodySRP14 Reaktivität: Human, Ratte, Hund, Rind (Kuh), Zebrafisch (Danio rerio), Kaninchen, Meerschweinchen, Pferd, Affe, Xenopus laevis, Huhn, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14) (AA 2-107) antibodySRP14 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14) (AA 28-55) antibodySRP14 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB39883 unconjugated
anti-Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14) antibodySRP14 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14) antibodyKO Validated SRP14 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14) (AA 1-136) antibodySRP14 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14) (AA 81-130) antibodySRP14 Reaktivität: Human, Ratte, Maus, Hund, Rind (Kuh), Zebrafisch (Danio rerio), Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14) (N-Term) antibodySRP14 Reaktivität: Human, Ratte, Maus, Hund, Rind (Kuh), Zebrafisch (Danio rerio), Kaninchen, Meerschweinchen, Pferd, Schaf WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SRP14 Blocking Peptide, catalog no. 33R-4587, is also available for use as a blocking control in assays to test for specificity of this SRP14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRP14 (Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14))
- Andere Bezeichnung
- SRP14 (SRP14 Produkte)
- Synonyme
- zgc:112290 antikoerper, 14kDa antikoerper, AW536328 antikoerper, ALURBP antikoerper, signal recognition particle 14 antikoerper, signal recognition particle 14kDa S homeolog antikoerper, srp14 antikoerper, Srp14 antikoerper, srp14.S antikoerper, SRP14 antikoerper
- Hintergrund
- SRP14 belongs to the SRP14 family. The signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.
- Molekulargewicht
- 15 kDa (MW of target protein)
-
