CPNE1 Antikörper (N-Term)

Produktnummer ABIN629980

Produktdetails anti-CPNE1 Antikörper

Target: CPNE1 (Copine I (CPNE1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPNE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Copine I antibody was raised against the N terminal of CPNE1

Aufreinigung: Purified

Immunogen: Copine I antibody was raised using the N terminal of CPNE1 corresponding to a region with amino acids TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Copine I Blocking Peptide, catalog no. 33R-9369, is also available for use as a blocking control in assays to test for specificity of this Copine I antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPNE1

Target: CPNE1 (Copine I (CPNE1))

Andere Bezeichnung: Copine I (CPNE1 Produkte)

Synonyme: CPNE1 antikoerper, MGC108079 antikoerper, COPN1 antikoerper, CPN1 antikoerper, 1810028N16Rik antikoerper, mKIAA4108 antikoerper, cpne3 antikoerper, cpne3l antikoerper, wu:fb69d07 antikoerper, wu:fc45a04 antikoerper, zgc:55873 antikoerper, copine I antikoerper, copine 1 antikoerper, RNA-binding protein 12 antikoerper, copine-1 antikoerper, copine I L homeolog antikoerper, CPNE1 antikoerper, cpne1 antikoerper, CPNE1b antikoerper, LOC100032499 antikoerper, LOC100484845 antikoerper, EDI_033120 antikoerper, LOC100281056 antikoerper, cpne1.L antikoerper, Cpne1 antikoerper

Hintergrund: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking.

Molekulargewicht: 59 kDa (MW of target protein)