PUF60 Antikörper (C-Term)

Produktnummer ABIN629984

Produktdetails anti-PUF60 Antikörper

Target: PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PUF60 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PUF60 antibody was raised against the C terminal of PUF60

Aufreinigung: Purified

Immunogen: PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PUF60 Blocking Peptide, catalog no. 33R-7261, is also available for use as a blocking control in assays to test for specificity of this PUF60 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUF60 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PUF60

Target: PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))

Andere Bezeichnung: PUF60 (PUF60 Produkte)

Synonyme: FIR antikoerper, RoBPI antikoerper, SIAHBP1 antikoerper, fc21a05 antikoerper, wu:fc21a05 antikoerper, wu:fi43a08 antikoerper, 2410104I19Rik antikoerper, 2810454F19Rik antikoerper, Siahbp1 antikoerper, fe37c05 antikoerper, repressor antikoerper, si:ch211-12p8.2 antikoerper, si:zc12p8.2 antikoerper, wu:fb33e11 antikoerper, wu:fe37c05 antikoerper, zgc:86806 antikoerper, poly(U) binding splicing factor 60 antikoerper, poly-U binding splicing factor a antikoerper, poly-U binding splicing factor 60 antikoerper, poly-U binding splicing factor b antikoerper, PUF60 antikoerper, puf60a antikoerper, Puf60 antikoerper, puf60b antikoerper

Hintergrund: PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.

Molekulargewicht: 58 kDa (MW of target protein)