PABPC4 Antikörper (N-Term)

Produktnummer ABIN629988

Produktdetails anti-PABPC4 Antikörper

Target: PABPC4 (Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PABPC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PABPC4 antibody was raised against the N terminal of PABPC4

Aufreinigung: Purified

Immunogen: PABPC4 antibody was raised using the N terminal of PABPC4 corresponding to a region with amino acids AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PABPC4 Blocking Peptide, catalog no. 33R-1137, is also available for use as a blocking control in assays to test for specificity of this PABPC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PABPC4

Target: PABPC4 (Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4))

Andere Bezeichnung: PABPC4 (PABPC4 Produkte)

Synonyme: cb12 antikoerper, sb:cb12 antikoerper, PABP antikoerper, ePAB antikoerper, ePABP antikoerper, APP-1 antikoerper, APP1 antikoerper, PABP4 antikoerper, iPABP antikoerper, polyadenylate-binding protein 4 antikoerper, poly(A) binding protein, cytoplasmic 4 antikoerper, poly(A) binding protein, cytoplasmic 4 (inducible form) antikoerper, poly(A) binding protein cytoplasmic 4 L homeolog antikoerper, poly(A) binding protein cytoplasmic 4 antikoerper, Bm1_06880 antikoerper, Pabpc4 antikoerper, pabpc4 antikoerper, pabpc4.L antikoerper, PABPC4 antikoerper

Hintergrund: Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells.

Molekulargewicht: 71 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom