SFPQ Antikörper
-
- Target Alle SFPQ Antikörper anzeigen
- SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SFPQ Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
- Top Product
- Discover our top product SFPQ Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFPQ Blocking Peptide, catalog no. 33R-9727, is also available for use as a blocking control in assays to test for specificity of this SFPQ antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFPQ antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))
- Andere Bezeichnung
- SFPQ (SFPQ Produkte)
- Synonyme
- 1110004P21Rik antikoerper, 2810416M14Rik antikoerper, 5730453G22Rik antikoerper, 9030402K04Rik antikoerper, AU021830 antikoerper, D4Ertd314e antikoerper, Gm12940 antikoerper, OTTMUSG00000009329 antikoerper, PSF antikoerper, REP1 antikoerper, hm:zeh0027 antikoerper, wu:fa11h12 antikoerper, wu:fd10f03 antikoerper, zgc:85935 antikoerper, POMP100 antikoerper, splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated) antikoerper, splicing factor proline/glutamine-rich antikoerper, splicing factor proline and glutamine rich antikoerper, Sfpq antikoerper, sfpq antikoerper, SFPQ antikoerper
- Hintergrund
- SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A.
- Molekulargewicht
- 78 kDa (MW of target protein)
-