SNRPF Antikörper (N-Term)
-
- Target Alle SNRPF Antikörper anzeigen
- SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SNRPF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SNRPF antibody was raised against the N terminal of SNRPF
- Aufreinigung
- Purified
- Immunogen
- SNRPF antibody was raised using the N terminal of SNRPF corresponding to a region with amino acids MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY
- Top Product
- Discover our top product SNRPF Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.31 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SNRPF Blocking Peptide, catalog no. 33R-6466, is also available for use as a blocking control in assays to test for specificity of this SNRPF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPF antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))
- Andere Bezeichnung
- SNRPF (SNRPF Produkte)
- Hintergrund
- SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.
- Molekulargewicht
- 9 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-