SNRPF Antikörper (N-Term)

Produktnummer ABIN629996

Produktdetails anti-SNRPF Antikörper

Target: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRPF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SNRPF antibody was raised against the N terminal of SNRPF

Aufreinigung: Purified

Immunogen: SNRPF antibody was raised using the N terminal of SNRPF corresponding to a region with amino acids MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY

Anwendungsinformationen

Applikationshinweise: WB: 0.31 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRPF Blocking Peptide, catalog no. 33R-6466, is also available for use as a blocking control in assays to test for specificity of this SNRPF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRPF

Target: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF))

Andere Bezeichnung: SNRPF (SNRPF Produkte)

Synonyme: BcDNA:GM23968 antikoerper, CG16792 antikoerper, Deb antikoerper, Deb-B antikoerper, DebB antikoerper, Dmel\\CG16792 antikoerper, dF antikoerper, deb-b antikoerper, snRNP-F antikoerper, sm-f antikoerper, smf antikoerper, snrpfl antikoerper, SMF antikoerper, Sm-F antikoerper, SmF antikoerper, 2010013O18Rik antikoerper, sm-F antikoerper, Small ribonucleoprotein particle protein SmF antikoerper, small nuclear ribonucleoprotein polypeptide F antikoerper, small nuclear ribonucleoprotein polypeptide F S homeolog antikoerper, SmF antikoerper, SNRPF antikoerper, snrpf antikoerper, Snrpf antikoerper, snrpf.S antikoerper

Hintergrund: SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.

Molekulargewicht: 9 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization