SFRS8 Antikörper (N-Term)
-
- Target Alle SFRS8 (SFSWAP) Antikörper anzeigen
- SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SFRS8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SFRS8 antibody was raised against the N terminal of SFRS8
- Aufreinigung
- Purified
- Immunogen
- SFRS8 antibody was raised using the N terminal of SFRS8 corresponding to a region with amino acids MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDER
- Top Product
- Discover our top product SFSWAP Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFRS8 Blocking Peptide, catalog no. 33R-6624, is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))
- Andere Bezeichnung
- SFRS8 (SFSWAP Produkte)
- Hintergrund
- SFRS8 is a human homolog of Drosophila splicing regulatory protein.
- Molekulargewicht
- 105 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-