APOBEC2 Antikörper (N-Term)

Produktnummer ABIN629998

Produktdetails anti-APOBEC2 Antikörper

Target: APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOBEC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ApoBEC2 antibody was raised against the N terminal of APOBEC2

Aufreinigung: Purified

Immunogen: ApoBEC2 antibody was raised using the N terminal of APOBEC2 corresponding to a region with amino acids VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ApoBEC2 Blocking Peptide, catalog no. 33R-9438, is also available for use as a blocking control in assays to test for specificity of this ApoBEC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOBEC2

Target: APOBEC2 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2))

Andere Bezeichnung: ApoBEC2 (APOBEC2 Produkte)

Synonyme: MGC84761 antikoerper, arp1 antikoerper, arcd1 antikoerper, MGC89256 antikoerper, APOBEC2 antikoerper, DKFZp468H1727 antikoerper, Arp1 antikoerper, ARCD1 antikoerper, ARP1 antikoerper, apolipoprotein B mRNA editing enzyme catalytic subunit 2 antikoerper, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 L homeolog antikoerper, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 antikoerper, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2 antikoerper, APOBEC2 antikoerper, apobec2.L antikoerper, apobec2 antikoerper, Apobec2 antikoerper

Hintergrund: APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.

Molekulargewicht: 25 kDa (MW of target protein)