RPL8 Antikörper (C-Term)

Produktnummer ABIN629999

Produktdetails anti-RPL8 Antikörper

Target: RPL8 (Ribosomal Protein L8 (RPL8))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RPL8 antibody was raised against the C terminal of RPL8

Aufreinigung: Purified

Immunogen: RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN

Anwendungsinformationen

Applikationshinweise: WB: 0.3125 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL8 Blocking Peptide, catalog no. 33R-2455, is also available for use as a blocking control in assays to test for specificity of this RPL8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL8

Target: RPL8 (Ribosomal Protein L8 (RPL8))

Andere Bezeichnung: RPL8 (RPL8 Produkte)

Synonyme: L8 antikoerper, zgc:73105 antikoerper, zgc:77641 antikoerper, CG1263 antikoerper, Dmel\\CG1263 antikoerper, M(3)62F antikoerper, M(3)LS2 antikoerper, Rp L8 antikoerper, anon-EST:Posey5 antikoerper, rpL8 antikoerper, RPL8 antikoerper, ribosomal protein L8 antikoerper, ribosomal protein L8 S homeolog antikoerper, Ribosomal protein L8 antikoerper, microRNA 6850 antikoerper, RPL8 antikoerper, Rpl8 antikoerper, rpl8.S antikoerper, rpl8 antikoerper, RpL8 antikoerper, MIR6850 antikoerper

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL8 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L2P family of ribosomal proteins. It is located in the cytoplasm.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Regulation of Cell Size