RBPMS Antikörper (N-Term)

Produktnummer ABIN630003

Produktdetails anti-RBPMS Antikörper

Target: RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBPMS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RBPMS antibody was raised against the N terminal of RBPMS

Aufreinigung: Purified

Immunogen: RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBPMS

Target: RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))

Andere Bezeichnung: RBPMS (RBPMS Produkte)

Synonyme: HERMES antikoerper, 2010300K22Rik antikoerper, 2700019M19Rik antikoerper, AU017537 antikoerper, hermes antikoerper, RGD1561067 antikoerper, si:cabz01079824.1 antikoerper, RNA binding protein with multiple splicing antikoerper, RNA binding protein gene with multiple splicing antikoerper, RNA binding protein with multiple splicing L homeolog antikoerper, RBPMS antikoerper, Rbpms antikoerper, rbpms.L antikoerper, rbpms antikoerper

Hintergrund: RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.

Molekulargewicht: 24 kDa (MW of target protein)