SNRNP70 Antikörper

Produktnummer ABIN630004

Produktdetails anti-SNRNP70 Antikörper

Target: SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRNP70 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNRP70 Blocking Peptide, catalog no. 33R-10176, is also available for use as a blocking control in assays to test for specificity of this SNRP70 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRP70 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRNP70

Target: SNRNP70 (Small Nuclear Ribonucleoprotein 70kDa (U1) (SNRNP70))

Andere Bezeichnung: SNRP70 (SNRNP70 Produkte)

Hintergrund: SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.

Molekulargewicht: 48 kDa (MW of target protein)