PPIE Antikörper

Produktnummer ABIN630008

Produktdetails anti-PPIE Antikörper

Target: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPIE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPIE Blocking Peptide, catalog no. 33R-4462, is also available for use as a blocking control in assays to test for specificity of this PPIE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPIE

Target: PPIE (Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE))

Andere Bezeichnung: PPIE (PPIE Produkte)

Synonyme: zgc:112471 antikoerper, CG4886 antikoerper, CYP33 antikoerper, Cyp33 antikoerper, Dcyp33 antikoerper, Dmel\\CG4886 antikoerper, PPIE antikoerper, cyp-33 antikoerper, cyp33 antikoerper, cype antikoerper, CYP-33 antikoerper, 2010010D16Rik antikoerper, Ab1-210 antikoerper, peptidylprolyl isomerase E (cyclophilin E) antikoerper, cyclophilin-33 antikoerper, peptidylprolyl isomerase E antikoerper, peptidylprolyl isomerase E (cyclophilin E) L homeolog antikoerper, ppie antikoerper, cyp33 antikoerper, PPIE antikoerper, ppie.L antikoerper, Ppie antikoerper

Hintergrund: PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain.

Molekulargewicht: 33 kDa (MW of target protein)