SNRNP35 Antikörper (N-Term)

Produktnummer ABIN630009

Produktdetails anti-SNRNP35 Antikörper

Target: SNRNP35 (U11/U12 SnRNP 35 KDa Protein)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNRNP35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: U1 SNRNPBP antibody was raised against the N terminal of U1 NRNPBP

Aufreinigung: Purified

Immunogen: U1 SNRNPBP antibody was raised using the N terminal of U1 NRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

U1SNRNPBP Blocking Peptide, catalog no. 33R-7830, is also available for use as a blocking control in assays to test for specificity of this U1SNRNPBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of U0 NRNPBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNRNP35

Target: SNRNP35 (U11/U12 SnRNP 35 KDa Protein)

Andere Bezeichnung: U1SNRNPBP (SNRNP35 Produkte)

Synonyme: MGC154877 antikoerper, u1snrnpbp antikoerper, RGD1310724 antikoerper, U1snrnpbp antikoerper, 6330548G22Rik antikoerper, zgc:112337 antikoerper, HM-1 antikoerper, U1SNRNPBP antikoerper, small nuclear ribonucleoprotein U11/U12 subunit 35 L homeolog antikoerper, small nuclear ribonucleoprotein U11/U12 subunit 35 antikoerper, small nuclear ribonucleoprotein 35 (U11/U12) antikoerper, snrnp35.L antikoerper, Snrnp35 antikoerper, snrnp35 antikoerper, SNRNP35 antikoerper

Hintergrund: U1SNRNPBP is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors.

Molekulargewicht: 28 kDa (MW of target protein)