RPLP0 Antikörper (Middle Region)
-
- Target Alle RPLP0 Antikörper anzeigen
- RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPLP0 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPLP0 antibody was raised against the middle region of RPLP0
- Aufreinigung
- Purified
- Immunogen
- RPLP0 antibody was raised using the middle region of RPLP0 corresponding to a region with amino acids PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY
- Top Product
- Discover our top product RPLP0 Primärantikörper
-
anti-Ribosomal Protein, Large, P0 (RPLP0) (AA 1-317) antibody
RPLP0 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 1B4 unconjugated
anti-Ribosomal Protein, Large, P0 (RPLP0) antibodyRPLP0 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein, Large, P0 (RPLP0) (AA 1-317) antibodyRPLP0 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Ribosomal Protein, Large, P0 (RPLP0) (AA 221-317) antibodyRPLP0 Reaktivität: Human, Maus WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein, Large, P0 (RPLP0) (AA 1-317) antibodyRPLP0 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein, Large, P0 (RPLP0) (AA 182-231) antibodyRPLP0 Reaktivität: Human, Maus, Hund, Rind (Kuh), Meerschweinchen, Pferd, Zebrafisch (Danio rerio), Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein, Large, P0 (RPLP0) (AA 96-145) antibodyRPLP0 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Zebrafisch (Danio rerio), Kaninchen, Affe, Schwein, Huhn, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein, Large, P0 (RPLP0) (N-Term) antibodyRPLP0 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein, Large, P0 (RPLP0) antibodyRPLP0 Reaktivität: Human, Maus, Ratte WB, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein, Large, P0 (RPLP0) (N-Term) antibodyRPLP0 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Zebrafisch (Danio rerio), Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPLP0 Blocking Peptide, catalog no. 33R-7085, is also available for use as a blocking control in assays to test for specificity of this RPLP0 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPLP0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))
- Andere Bezeichnung
- RPLP0 (RPLP0 Produkte)
- Hintergrund
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2.
- Molekulargewicht
- 35 kDa (MW of target protein)
-
