PRP6/ANT-1 Antikörper
-
- Target Alle PRP6/ANT-1 (PRPF6) Antikörper anzeigen
- PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRP6/ANT-1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR
- Top Product
- Discover our top product PRPF6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRPF6 Blocking Peptide, catalog no. 33R-3130, is also available for use as a blocking control in assays to test for specificity of this PRPF6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRP6/ANT-1 (PRPF6) (PRP6 Pre-mRNA Processing Factor 6 Homolog (PRPF6))
- Andere Bezeichnung
- PRPF6 (PRPF6 Produkte)
- Hintergrund
- PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.
- Molekulargewicht
- 104 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Proton Transport, Dicarboxylic Acid Transport
-