MIF4GD Antikörper (C-Term)
-
- Target Alle MIF4GD Antikörper anzeigen
- MIF4GD (MIF4G Domain Containing (MIF4GD))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Hund, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MIF4GD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- MIF4 GD antibody was raised against the C terminal of MIF4 D
- Aufreinigung
- Purified
- Immunogen
- MIF4 GD antibody was raised using the C terminal of MIF4 D corresponding to a region with amino acids LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
- Top Product
- Discover our top product MIF4GD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MIF4GD Blocking Peptide, catalog no. 33R-4954, is also available for use as a blocking control in assays to test for specificity of this MIF4GD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIF0 D antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MIF4GD (MIF4G Domain Containing (MIF4GD))
- Andere Bezeichnung
- MIF4GD (MIF4GD Produkte)
- Hintergrund
- MIF4GD is a protein which contains an MIF4G domain.
- Molekulargewicht
- 28 kDa (MW of target protein)
-