MTHFSD Antikörper (N-Term)
-
- Target Alle MTHFSD Antikörper anzeigen
- MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTHFSD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- MTHFSD antibody was raised against the N terminal of MTHFSD
- Aufreinigung
- Purified
- Immunogen
- MTHFSD antibody was raised using the N terminal of MTHFSD corresponding to a region with amino acids EVKVDPDKPLEGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDIL
- Top Product
- Discover our top product MTHFSD Primärantikörper
-
anti-Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (AA 60-109) antibody
MTHFSD Reaktivität: Human, Maus, Hund, Rind (Kuh), Pferd, Kaninchen, Zebrafisch (Danio rerio) WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (AA 43-69), (N-Term) antibodyMTHFSD Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37723 unconjugated
anti-Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (N-Term) antibodyMTHFSD Reaktivität: Human, Maus, Hund, Rind (Kuh), Pferd, Kaninchen, Meerschweinchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (AA 1-383) antibodyMTHFSD Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (N-Term) antibodyMTHFSD Reaktivität: Human, Maus, Hund, Rind (Kuh), Pferd, Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio), Schwein, Ratte WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MTHFSD Blocking Peptide, catalog no. 33R-2798, is also available for use as a blocking control in assays to test for specificity of this MTHFSD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFSD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTHFSD (Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD))
- Andere Bezeichnung
- MTHFSD (MTHFSD Produkte)
- Synonyme
- MTHFSD antikoerper, DKFZp469G0629 antikoerper, fc43c12 antikoerper, si:dkey-199i24.1 antikoerper, wu:fc43c12 antikoerper, zgc:153374 antikoerper, AW049977 antikoerper, BC052066 antikoerper, C920004D05 antikoerper, methenyltetrahydrofolate synthetase domain containing antikoerper, methenyltetrahydrofolate synthetase domain containing L homeolog antikoerper, MTHFSD antikoerper, mthfsd antikoerper, mthfsd.L antikoerper, Mthfsd antikoerper
- Hintergrund
- The function remains unknows.
- Molekulargewicht
- 41 kDa (MW of target protein)
-
