RBM4B Antikörper (C-Term)
-
- Target Alle RBM4B Antikörper anzeigen
- RBM4B (RNA Binding Motif Protein 4B (RBM4B))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBM4B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- RBM4 B antibody was raised against the C terminal of RBM4
- Aufreinigung
- Purified
- Immunogen
- RBM4 B antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL
- Top Product
- Discover our top product RBM4B Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBM4B Blocking Peptide, catalog no. 33R-1001, is also available for use as a blocking control in assays to test for specificity of this RBM4B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM4B (RNA Binding Motif Protein 4B (RBM4B))
- Andere Bezeichnung
- RBM4B (RBM4B Produkte)
- Hintergrund
- RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Photoperiodism
-