RBM4B Antikörper (C-Term)

Produktnummer ABIN630027

Produktdetails anti-RBM4B Antikörper

Target: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RBM4 B antibody was raised against the C terminal of RBM4

Aufreinigung: Purified

Immunogen: RBM4 B antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM4B Blocking Peptide, catalog no. 33R-1001, is also available for use as a blocking control in assays to test for specificity of this RBM4B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM4B

Target: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Andere Bezeichnung: RBM4B (RBM4B Produkte)

Hintergrund: RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Photoperiodism