RAVER1 Antikörper (N-Term)

Produktnummer ABIN630030

Produktdetails anti-RAVER1 Antikörper

Target: RAVER1 (Ribonucleoprotein, PTB-Binding 1 (RAVER1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAVER1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RAVER1 antibody was raised against the N terminal of RAVER1

Aufreinigung: Purified

Immunogen: RAVER1 antibody was raised using the N terminal of RAVER1 corresponding to a region with amino acids VTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAVER1 Blocking Peptide, catalog no. 33R-9845, is also available for use as a blocking control in assays to test for specificity of this RAVER1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAVER1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAVER1

Target: RAVER1 (Ribonucleoprotein, PTB-Binding 1 (RAVER1))

Andere Bezeichnung: RAVER1 (RAVER1 Produkte)

Synonyme: MGC83237 antikoerper, zgc:112236 antikoerper, RAVER1 antikoerper, Raver1h antikoerper, 1300006N24Rik antikoerper, AA050359 antikoerper, mKIAA1978 antikoerper, hypothetical protein antikoerper, ribonucleoprotein, PTB-binding 1 S homeolog antikoerper, ribonucleoprotein, PTB-binding 1 antikoerper, ribonucleoprotein, PTB binding 1 antikoerper, Raver1 antikoerper, raver1.S antikoerper, raver1 antikoerper, RAVER1 antikoerper

Hintergrund: RAVER1 contains 3 RRM (RNA recognition motif) domains. It cooperates with PTBP1 to modulate regulated alternative splicing events and promotes exon skipping.

Molekulargewicht: 67 kDa (MW of target protein)