DIS3L2 Antikörper (N-Term)
-
- Target Alle DIS3L2 Antikörper anzeigen
- DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DIS3L2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- MGC42174 antibody was raised against the N terminal Of Mgc42174
- Aufreinigung
- Purified
- Immunogen
- MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF
- Top Product
- Discover our top product DIS3L2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MGC42174 Blocking Peptide, catalog no. 33R-9966, is also available for use as a blocking control in assays to test for specificity of this MGC42174 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC42174 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DIS3L2 (DIS3-Like Exonuclease 2 (DIS3L2))
- Abstract
- DIS3L2 Produkte
- Hintergrund
- MGC42174 is a probable exonuclease.
- Molekulargewicht
- 68 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance
-