PCBP1 Antikörper
-
- Target Alle PCBP1 Antikörper anzeigen
- PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCBP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM
- Top Product
- Discover our top product PCBP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCBP1 Blocking Peptide, catalog no. 33R-1804, is also available for use as a blocking control in assays to test for specificity of this PCBP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCBP1 (Poly(rC) Binding Protein 1 (PCBP1))
- Andere Bezeichnung
- PCBP1 (PCBP1 Produkte)
- Synonyme
- PCBP1 antikoerper, HNRPE1 antikoerper, HNRPX antikoerper, hnRNP-E1 antikoerper, hnRNP-X antikoerper, hnRNP E1 antikoerper, WBP17 antikoerper, [a]CP-1 antikoerper, alphaCP-1 antikoerper, RGD1561319 antikoerper, poly(rC) binding protein 1 antikoerper, poly(rC) binding protein 1 L homeolog antikoerper, poly(rC)-binding protein 1 antikoerper, PCBP1 antikoerper, pcbp1.L antikoerper, LOC100388387 antikoerper, Pcbp1 antikoerper
- Hintergrund
- PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA.
- Molekulargewicht
- 39 kDa (MW of target protein)
-