Cytokeratin 18 Antikörper (N-Term)
-
- Target Alle Cytokeratin 18 (KRT18) Antikörper anzeigen
- Cytokeratin 18 (KRT18) (Keratin 18 (KRT18))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cytokeratin 18 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Cytokeratin 18 antibody was raised against the N terminal of KRT18
- Aufreinigung
- Purified
- Immunogen
- Cytokeratin 18 antibody was raised using the N terminal of KRT18 corresponding to a region with amino acids TRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSF
- Top Product
- Discover our top product KRT18 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cytokeratin 18 Blocking Peptide, catalog no. 33R-9270, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 18 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT18 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cytokeratin 18 (KRT18) (Keratin 18 (KRT18))
- Andere Bezeichnung
- Cytokeratin 18 (KRT18 Produkte)
- Synonyme
- CK18 antikoerper, K18 antikoerper, Krt1-18 antikoerper, CYK18 antikoerper, DreK18 antikoerper, cb83 antikoerper, dapk1 antikoerper, sb:cb83 antikoerper, wu:fa13f02 antikoerper, wu:fb36b04 antikoerper, krt18 antikoerper, MGC64569 antikoerper, MGC75922 antikoerper, KRT18 antikoerper, CK-18-A antikoerper, K18-A antikoerper, NC-11 antikoerper, cyk18 antikoerper, k18 antikoerper, krt18-a antikoerper, krt18-b antikoerper, krt18a antikoerper, xkendob antikoerper, keratin 18 antikoerper, keratin 18, type I L homeolog antikoerper, keratin 18, type I antikoerper, keratin, type I cytoskeletal 18 antikoerper, K18, simple type I keratin antikoerper, Keratin, type I cytoskeletal 18 antikoerper, keratin 18, type I S homeolog antikoerper, Krt18 antikoerper, KRT18 antikoerper, krt18 antikoerper, krt18.L antikoerper, LOC700569 antikoerper, LOC100136778 antikoerper, k1c18 antikoerper, LOC100008885 antikoerper, krt18.S antikoerper
- Hintergrund
- KRT18 (Keratin 18) is type I intermediate filament chain. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis.KRT18 encodes the type I intermediate filament chain keratin 18.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Apoptose, Caspase Kaskade in der Apoptose
-