DDX17 Antikörper

Produktnummer ABIN630050

Produktdetails anti-DDX17 Antikörper

Target: DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGY

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX17 Blocking Peptide, catalog no. 33R-9297, is also available for use as a blocking control in assays to test for specificity of this DDX17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX17

Target: DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))

Andere Bezeichnung: DDX17 (DDX17 Produkte)

Synonyme: MGC80019 antikoerper, DDX17 antikoerper, P72 antikoerper, RH70 antikoerper, Cp68 antikoerper, DDX46 antikoerper, 2610007K22Rik antikoerper, A430025E01Rik antikoerper, AI047725 antikoerper, C80929 antikoerper, Gm926 antikoerper, p72 antikoerper, DEAD-box helicase 17 L homeolog antikoerper, probable ATP-dependent RNA helicase DDX17 antikoerper, DEAD-box helicase 17 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 antikoerper, ddx17.L antikoerper, LOC412313 antikoerper, DDX17 antikoerper, ddx17 antikoerper, Ddx17 antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Muscle Cell Differentiation