APOO Antikörper (C-Term)

Produktnummer ABIN630052

Produktdetails anti-APOO Antikörper

Target: APOO (Apolipoprotein O (APOO))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM121 B antibody was raised against the C terminal Of Fam121

Aufreinigung: Purified

Immunogen: FAM121 B antibody was raised using the C terminal Of Fam121 corresponding to a region with amino acids LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM121B Blocking Peptide, catalog no. 33R-5578, is also available for use as a blocking control in assays to test for specificity of this FAM121B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOO

Target: APOO (Apolipoprotein O (APOO))

Andere Bezeichnung: FAM121B (APOO Produkte)

Synonyme: fam121b antikoerper, fp74f12 antikoerper, wu:fp74f12 antikoerper, zgc:123314 antikoerper, my025 antikoerper, FAM121B antikoerper, 0610008C08Rik antikoerper, 1110019O03Rik antikoerper, RGD1565289 antikoerper, MGC79016 antikoerper, si:rp71-1f1.3 antikoerper, wu:fr42a11 antikoerper, zgc:103766 antikoerper, apolipoprotein O, a antikoerper, apolipoprotein O antikoerper, apolipoprotein O L homeolog antikoerper, apolipoprotein O, b antikoerper, apooa antikoerper, apoo antikoerper, APOO antikoerper, Apoo antikoerper, apoo.L antikoerper, apoob antikoerper

Hintergrund: FAM121B belongs to the FAM121 family and the function remains unknown.

Molekulargewicht: 22 kDa (MW of target protein)