TMED4 Antikörper (N-Term)
-
- Target Alle TMED4 Antikörper anzeigen
- TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMED4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- TMED4 antibody was raised against the N terminal of TMED4
- Aufreinigung
- Purified
- Immunogen
- TMED4 antibody was raised using the N terminal of TMED4 corresponding to a region with amino acids LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
- Top Product
- Discover our top product TMED4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMED4 Blocking Peptide, catalog no. 33R-5347, is also available for use as a blocking control in assays to test for specificity of this TMED4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))
- Andere Bezeichnung
- TMED4 (TMED4 Produkte)
- Synonyme
- TMED4 antikoerper, ERS25 antikoerper, HNLF antikoerper, 1110014L17Rik antikoerper, AI326346 antikoerper, fc88h09 antikoerper, wu:fc88h09 antikoerper, zgc:86755 antikoerper, ers25 antikoerper, hnlf antikoerper, RGD1306319 antikoerper, transmembrane p24 trafficking protein 4 antikoerper, transmembrane p24 trafficking protein 4 S homeolog antikoerper, TMED4 antikoerper, Tmed4 antikoerper, tmed4 antikoerper, tmed4.S antikoerper
- Hintergrund
- TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.
- Molekulargewicht
- 25 kDa (MW of target protein)
-