DDX41 Antikörper
-
- Target Alle DDX41 Antikörper anzeigen
- DDX41 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41))
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDX41 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- DDX41 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGL
- Top Product
- Discover our top product DDX41 Primärantikörper
-
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41) (AA 523-622) antibody
DDX41 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 2F4 unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41) (AA 1-300) antibodyDDX41 Reaktivität: Human WB, IF, IHC, IP Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41) (N-Term) antibodyDDX41 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41) (AA 141-169), (N-Term) antibodyDDX41 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB40392 unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41) antibodyDDX41 Reaktivität: Human, Maus, Ratte WB, IF, IHC, IC Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41) (Center) antibodyDDX41 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41) (AA 447-496) antibodyDDX41 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Fledermaus, Schwein, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41) (AA 71-120) antibodyDDX41 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Fledermaus, Schwein, Huhn, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDX41 Blocking Peptide, catalog no. 33R-1267, is also available for use as a blocking control in assays to test for specificity of this DDX41 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX41 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX41 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41))
- Andere Bezeichnung
- DDX41 (DDX41 Produkte)
- Hintergrund
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Based on studies in Drosophila, the abstrakt gene is widely required during post-transcriptional gene expression.
- Molekulargewicht
- 68 kDa (MW of target protein)
-
