DDX41 Antikörper

Produktnummer ABIN630056

Produktdetails anti-DDX41 Antikörper

Target: DDX41 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX41 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: DDX41 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX41 Blocking Peptide, catalog no. 33R-1267, is also available for use as a blocking control in assays to test for specificity of this DDX41 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX41 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX41

Target: DDX41 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41))

Andere Bezeichnung: DDX41 (DDX41 Produkte)

Synonyme: DDX41 antikoerper, ABS antikoerper, 2900024F02Rik antikoerper, AA958953 antikoerper, AI324246 antikoerper, wu:fb92e02 antikoerper, zgc:55896 antikoerper, DEAD-box helicase 41 antikoerper, probable ATP-dependent RNA helicase DDX41 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 antikoerper, DDX41 antikoerper, LOC100215941 antikoerper, ddx41 antikoerper, LOC100638079 antikoerper, Ddx41 antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Based on studies in Drosophila, the abstrakt gene is widely required during post-transcriptional gene expression.

Molekulargewicht: 68 kDa (MW of target protein)