CLCN3 Antikörper (C-Term)
-
- Target Alle CLCN3 Antikörper anzeigen
- CLCN3 (Chloride Channel 3 (CLCN3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CLCN3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- CLCN3 antibody was raised against the C terminal of CLCN3
- Aufreinigung
- Purified
- Immunogen
- CLCN3 antibody was raised using the C terminal of CLCN3 corresponding to a region with amino acids MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD
- Top Product
- Discover our top product CLCN3 Primärantikörper
-
anti-Chloride Channel 3 (CLCN3) (C-Term) antibody
CLCN3 Reaktivität: Ratte, Human, Maus, Meerschweinchen, Kaninchen, Hund, Zebrafisch (Danio rerio), Pferd, Rind (Kuh), Schaf WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Chloride Channel 3 (CLCN3) (N-Term) antibodyCLCN3 Reaktivität: Ratte, Human, Maus WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibodyCLCN3 Reaktivität: Ratte WB, IHC, ICC, IF Wirt: Maus Monoclonal S258-5 unconjugated
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (HRP)CLCN3 Reaktivität: Ratte WB, IHC, ICC, IF Wirt: Maus Monoclonal S258-5 HRP
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (FITC)CLCN3 Reaktivität: Ratte WB, IHC, ICC, IF Wirt: Maus Monoclonal S258-5 FITC
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (Biotin)CLCN3 Reaktivität: Ratte WB, IHC, ICC, IF Wirt: Maus Monoclonal S258-5 Biotin
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (PE)CLCN3 Reaktivität: Ratte WB, IHC, ICC, IF Wirt: Maus Monoclonal S258-5 PE
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (APC)CLCN3 Reaktivität: Ratte WB, IHC, ICC, IF Wirt: Maus Monoclonal S258-5 APC
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (PerCP)CLCN3 Reaktivität: Ratte WB, IHC, ICC, IF Wirt: Maus Monoclonal S258-5 PerCP
anti-Chloride Channel 3 (CLCN3) (AA 98-115) antibody (Atto 594)CLCN3 Reaktivität: Ratte WB, IHC, ICC, IF Wirt: Maus Monoclonal S258-5 Atto 594
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CLCN3 Blocking Peptide, catalog no. 33R-5956, is also available for use as a blocking control in assays to test for specificity of this CLCN3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCN3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLCN3 (Chloride Channel 3 (CLCN3))
- Andere Bezeichnung
- CLCN3 (CLCN3 Produkte)
- Synonyme
- CLC3 antikoerper, ClC-3 antikoerper, Clc3 antikoerper, CLCN3 antikoerper, fb78c02 antikoerper, wu:fb78c02 antikoerper, clc3 antikoerper, clc-3 antikoerper, chloride voltage-gated channel 3 antikoerper, chloride channel, voltage-sensitive 3 antikoerper, chloride channel 3 antikoerper, chloride channel protein 3 antikoerper, chloride channel, voltage-sensitive 3 S homeolog antikoerper, CLCN3 antikoerper, Clcn3 antikoerper, clcn3 antikoerper, PTRG_03131 antikoerper, BDBG_05668 antikoerper, MCYG_04420 antikoerper, clcn3.S antikoerper
- Hintergrund
- CLCN3 plays an important role in the cell proliferation of vascular smooth muscle cells. The PDZ-binding isoform of CLCN3 resides in the Golgi where it co-localizes with a small amount of CFTR (cystic fibrosis transmembrane conductance regulator).
- Molekulargewicht
- 95 kDa (MW of target protein)
-
